• LIXISENATIDE chembl:CHEMBL2108336 Approved

    Alternate Names:

    AVE 010
    ZP 10
    LYXUMIA
    ADLYXIN
    ZP-10
    AVE-0010
    LIXISENATIDE
    AVE-010
    DESPRO38EXENDIN-4(1-39)-LYS6-NH2
    ZP10A PEPTIDE
    AVE 0010
    AVE0010
    H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2
    AQVE-10010
    DES-38-PROLINE-EXENDINE-4 (HELODERMA SUSPECTUM)-(1-39)-PEPTIDYLPENTA-L-LYSYL-L-LYSINAMIDE
    H-HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-SER-LYS-LYS-LYS-LYS-LYS-LYS-NH2
    chemidplus:320367-13-3
    drugbank:09265
    chembl:CHEMBL2108336
    rxcui:1440051
    pubchem.compound:90472060

    Drug Info:

    (0 More Sources)

    Publications:

  • Interaction Score: 1.26

    Interaction Types & Directionality:
    agonist (activating)

    Interaction Info:
    Mechanism of Interaction Glucagon-like peptide 1 receptor agonist
    Direct Interaction yes
    Details of the Assay for Interaction CHO-K1 cells overexpressing the human GLP-1 receptor.

    PMIDs:
    None found